Loading...
Statistics
Advertisement

TOTM: Therapy on the Move
www.totm.life/
TOTM | Therapy on the Move. A counselling team in Bayside, Victoria, CBT (Cognitive Behavioural Therapy) approaches and Clinical Family Therapy

Totm.life

Advertisement
Conversion Technology Metas Server
Totm.life is hosted in United States . Totm.life uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: TQIz9b1OS-YYhQl...NEYqC39.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: cloudflare-nginx. Its CMS is: Squarespace.

Technologies in use by Totm.life

Technology

Number of occurences: 6
  • CSS
  • Html
  • Javascript
  • Lightbox
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 1
  • TQIz9b1OS-YYhQldEXEfqYXDQgyuWxB9MvVSnwpGj3SfelIIf4e6pUJ6wRMU5QwXFmvuFRZ8jQqkFR8RjAsKFc4cFh93Z2Suw26-ZWiaikoXdaslOcUTZc9CieNXdPoC-AZ8OeUzjhBC-eNDifUX-emkjWgodhoX-emldaZ8O1FUiABkZWF3jAF8OcFzdP37O1sGZW4ySY8zd1sGZAuzic90SaBujW48Sagyjh90jhNlJygcScmTZhyXOWFyd1wlSY4zJ6iRjAUCiAoyJ68ciWsuScIlSYbKgcmuScN3jPG4f4gTIMMjMkMfH6qJqAqbMg6FJMJ7fbRHmsMMeMb6MKG4fJuTIMMj2KMfH6qJqcqbMg6BJMJ7fbKQ-sMMeMv6MKG4f4sTIMMjgKMfH6qJ8AqbMg6bJMJ7fbK5-sMMeMS6MKG4fJNTIMMjIPMfH6qJ8cqbMg64JMJ7fbKW-sMMegw6MKG4f4M3IMIjMkMfH6qJDbvbMs6IJMJ7fbR52UMgeMt6MKG4f5JVIMIjgKMfH6qJtbvbMs6bJMJ7fbRV2UMgeMS6MKG4fFMVIMIjIPMfH6qJcUMbMs64JMJ7fbKemsMfeMw6MKG4fJFmIMJj2PMfH6qJyB9bMy6IJMJ7fbKBmsMfeMt6MKG4fVN9IMJjgPMfH6qJ6B9bMy6VJMJ7fbKgmsMfeMS6MKG4fJ4mIMJjIPMfH6qJyu9bMy6JJMJ7fbKJmsMfegJ6MKG4fH8oIMwjMkMfH6GJttjgIMwj2PMfH6qJ71qbMU6IJMJ7f6Rqy6IbMU65JMJ7fbKGpsM2eMS6MKGHf5AeMsM2egI6MTMgNEYqC39.js

Content Management System

Number of occurences: 1
  • Squarespace

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • cloudflare-nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Totm.life

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Multi-Domain/CN=sni164656.cloudflaressl.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Multi-Domain
      • CN: sni164656.cloudflaressl.com
    • hash: 172531ba
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO ECC Domain Validation Secure Server CA 2
    • version: 2
    • serialNumber: 248446341379281878876869405066314983515
    • validFrom: 160909000000Z
    • validTo: 170312235959Z
    • validFrom_time_t: 1473379200
    • validTo_time_t: 1489363199
    • extensions:
      • authorityKeyIdentifier: keyid:40:09:61:67:F0:BC:83:71:4F:DE:12:08:2C:6F:D4:D4:2B:76:3D:96
      • subjectKeyIdentifier: 08:03:39:92:3C:59:F1:8C:6D:D8:57:E5:59:B9:34:F0:C6:F8:75:FF
      • keyUsage: Digital Signature
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crt OCSP - URI:http://ocsp.comodoca4.com
      • subjectAltName: DNS:sni164656.cloudflaressl.com, DNS:*.accidentattorneysf.com, DNS:*.accidentlegaldirectory.com, DNS:*.airbagaccidentlawsuit.com, DNS:*.airbaginjurylawsuits.com, DNS:*.babelyx.com, DNS:*.bbcaction.com, DNS:*.bestnorcalhvac.com, DNS:*.blogsoftnewsu.xyz, DNS:*.blogsofttool96.xyz, DNS:*.californiaabagado.com, DNS:*.californiaaccidentdirectory.com, DNS:*.californiaairbaglawsuit.com, DNS:*.californiaconstructiondefectlawyer.com, DNS:*.californiazofranlawsuit.com, DNS:*.chryslerignitionlawsuit.com, DNS:*.coachellalawyer.com, DNS:*.hip-problems.com, DNS:*.hustler.ai, DNS:*.hustler.social, DNS:*.injuryfrombirth.com, DNS:*.invokana-problems.com, DNS:*.kctlegal.com, DNS:*.kneerecallresourcecenter.com, DNS:*.kusovy-koberec.eu, DNS:*.lasvegaslawfirmmarketing.com, DNS:*.legalselfie.com, DNS:*.masstortreport.com, DNS:*.millerinjurylaw.com, DNS:*.mmattorneys.com, DNS:*.navistarlawsuit.com, DNS:*.negotiatelikethepros.com, DNS:*.omnipoddefectresourcecenter.com, DNS:*.paxil-problems-lawsuit.com, DNS:*.philadelphialawfirmmarketing.net, DNS:*.phoenixlawfirmmarketing.com, DNS:*.pms35.nl, DNS:*.previewmediasmack.net, DNS:*.renolawfirmmarketing.com, DNS:*.risperdal-problems.com, DNS:*.selfio.eu, DNS:*.ssriproblems.com, DNS:*.stevensonmurray.com, DNS:*.talcumpowderproblems.com, DNS:*.thelegalinfo.guru, DNS:*.totm.life, DNS:*.tubanten.nl, DNS:*.underwroughtgomphocarpusparticipative.site, DNS:*.vanslut.com, DNS:*.verywebsitesofti6.xyz, DNS:accidentattorneysf.com, DNS:accidentlegaldirectory.com, DNS:airbagaccidentlawsuit.com, DNS:airbaginjurylawsuits.com, DNS:babelyx.com, DNS:bbcaction.com, DNS:bestnorcalhvac.com, DNS:blogsoftnewsu.xyz, DNS:blogsofttool96.xyz, DNS:californiaabagado.com, DNS:californiaaccidentdirectory.com, DNS:californiaairbaglawsuit.com, DNS:californiaconstructiondefectlawyer.com, DNS:californiazofranlawsuit.com, DNS:chryslerignitionlawsuit.com, DNS:coachellalawyer.com, DNS:hip-problems.com, DNS:hustler.ai, DNS:hustler.social, DNS:injuryfrombirth.com, DNS:invokana-problems.com, DNS:kctlegal.com, DNS:kneerecallresourcecenter.com, DNS:kusovy-koberec.eu, DNS:lasvegaslawfirmmarketing.com, DNS:legalselfie.com, DNS:masstortreport.com, DNS:millerinjurylaw.com, DNS:mmattorneys.com, DNS:navistarlawsuit.com, DNS:negotiatelikethepros.com, DNS:omnipoddefectresourcecenter.com, DNS:paxil-problems-lawsuit.com, DNS:philadelphialawfirmmarketing.net, DNS:phoenixlawfirmmarketing.com, DNS:pms35.nl, DNS:previewmediasmack.net, DNS:renolawfirmmarketing.com, DNS:risperdal-problems.com, DNS:selfio.eu, DNS:ssriproblems.com, DNS:stevensonmurray.com, DNS:talcumpowderproblems.com, DNS:thelegalinfo.guru, DNS:totm.life, DNS:tubanten.nl, DNS:underwroughtgomphocarpusparticipative.site, DNS:vanslut.com, DNS:verywebsitesofti6.xyz

Meta - Totm.life

Number of occurences: 8
  • Name:
    Content: http://static1.squarespace.com/static/566ea9269cadb6bf7e0d7508/t/566eb36ae0327c1e779a1d96/1450095567847/?format=1000w
  • Name: viewport
    Content: width=device-width,initial-scale=1,shrink-to-fit=no
  • Name: twitter:title
    Content: TOTM: Therapy on the Move
  • Name: twitter:image
    Content: http://static1.squarespace.com/static/566ea9269cadb6bf7e0d7508/t/566eb36ae0327c1e779a1d96/1450095567847/?format=1000w
  • Name: twitter:url
    Content: http://www.totm.life/
  • Name: twitter:card
    Content: summary
  • Name: description
    Content: TOTM | Therapy on the Move. A counselling team in Bayside, Victoria, CBT (Cognitive Behavioural Therapy) approaches and Clinical Family Therapy
  • Name: google-site-verification
    Content: WYq6gNQCmSMgYSpVaVSYZZWQnf0uLqP6wXrfcn1jy0E

Server / Hosting

  • IP: 104.31.71.202
  • Latitude: 37.75
  • Longitude: -97.82
  • Country: United States

Rname

  • vick.ns.cloudflare.com
  • deb.ns.cloudflare.com
  • alt4.aspmx.l.google.com
  • alt1.aspmx.l.google.com
  • alt2.aspmx.l.google.com
  • alt3.aspmx.l.google.com
  • aspmx.l.google.com

Target

  • dns.cloudflare.com

HTTP Header Response

HTTP/1.1 200 OK Date: Thu, 29 Sep 2016 04:43:51 GMT Content-Type: text/html; charset=UTF-8 Set-Cookie: __cfduid=dc2699d6b2502210dd58af4d81223d27f1475124231; expires=Fri, 29-Sep-17 04:43:51 GMT; path=/; domain=.totm.life; HttpOnly X-ServedBy: web126 Set-Cookie: crumb=BNnVZufeZQEKZWUxZTQ0MTA4YjI3OTY0MGMxZDU5YjQ3MzBiNzg4;Path=/ Expires: Thu, 01 Jan 1970 00:00:00 GMT Set-Cookie: SS_MID=1e92a112-129c-47a2-a042-baf408015659itnuvpbx;Path=/;Domain=.totm.life;Expires=Sun, 27-Sep-2026 04:43:51 GMT X-PC-Key: LEsrHGl0NrDWJN7KE4Nqd8VDSTA-therapyonthemove X-PC-Hit: false X-PC-AppVer: 9005 Vary: Accept-Encoding, User-Agent X-ContextId: th66Z8fr/XFyMZRUJ X-Via: 1.1 echo106 Server: cloudflare-nginx CF-RAY: 2e9cc6cc363254f8-ORD X-Cache: MISS from s_hv897 Transfer-Encoding: chunked Via: 1.1 s_hv897 (squid/3.5.20) Connection: keep-alive

DNS

host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.31.70.202
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.31.71.202
host: totm.life
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: vick.ns.cloudflare.com
host: totm.life
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: deb.ns.cloudflare.com
host: totm.life
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: deb.ns.cloudflare.com
  5. rname: dns.cloudflare.com
  6. serial: 2020501690
  7. refresh: 10000
  8. retry: 2400
  9. expire: 604800
  10. minimum-ttl: 3600
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: alt4.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 5
  5. target: alt1.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 5
  5. target: alt2.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: alt3.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 1
  5. target: aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: TXT
  4. txt: google-site-verification=ZMqFxbfypWHONkcLXdLy3_7C0tiwizun_R6YFo6JvTg
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.otm.life, www.tqotm.life, www.qotm.life, www.taotm.life, www.aotm.life, www.t otm.life, www. otm.life, www.twotm.life, www.wotm.life, www.teotm.life, www.eotm.life, www.tzotm.life, www.zotm.life, www.txotm.life, www.xotm.life, www.tcotm.life, www.cotm.life, www.ttm.life, www.tobtm.life, www.tbtm.life, www.tohtm.life, www.thtm.life, www.togtm.life, www.tgtm.life, www.tojtm.life, www.tjtm.life, www.tomtm.life, www.tmtm.life, www.to tm.life, www.t tm.life, www.tovtm.life, www.tvtm.life, www.tom.life, www.totqm.life, www.toqm.life, www.totam.life, www.toam.life, www.tot m.life, www.to m.life, www.totwm.life, www.towm.life, www.totem.life, www.toem.life, www.totzm.life, www.tozm.life, www.totxm.life, www.toxm.life, www.totcm.life, www.tocm.life, www.tot.life, www.totmp.life, www.totp.life, www.totmo.life, www.toto.life, www.totmi.life, www.toti.life, www.totmk.life, www.totk.life, www.totm..life, www.tot..life, www.totmu.life, www.totu.life, www.totmj.life, www.totj.life, www.totmn.life, www.totn.life, www.totm-.life, www.tot-.life,

Other websites we recently analyzed

  1. Hazons Space :: Welcome
    Houston (United States) - 192.185.143.9
    Server software: nginx/1.10.1
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 1
    Number of meta tags: 1
  2. krowdtrading.us
    Scottsdale (United States) - 50.63.202.37
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  3. alexrho.de
    Germany - 85.13.151.77
    Server software: Apache
    Technology: CSS, Html, SVG
  4. tzxlsp.com
    Xian (China) - 218.247.87.245
    Server software: wts/1.1
    Technology: CSS, Html, Iframe, Javascript
    Number of Javascript: 1
    Number of meta tags: 1
  5. dvd9-sale.com
    Orange (United States) - 98.126.84.189
    Server software: IIS
    Technology: Html
    Number of meta tags: 1
  6. ecpfjz.win
    San Jose (United States) - 23.27.192.115
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. Navig8 - Navigate to your gate
    Navig8 ist ein Prototyp für die App des Flughafens Zürich, welche auf innovative Weise zunehmend aufkommende Bedürfnisse und Probleme der Reisenden adressiert und im Rahmen der Accenture Campus Innovation Challenge 2013 mit dem 1. Platz gekürt wurde.
    Switzerland - 80.74.145.170
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, OSS CDN, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php
    Number of Javascript: 4
    Number of meta tags: 4
  8. Strona główna - INTERSCHOOL - Szkoła Języków Obcych - angielski, niemiecki, hiszpański
    INTERSCHOOL - Szkoła Języków Obcych - angielski, niemiecki, hiszpański
    Poland - 85.128.186.200
    Server software: Apache/2
    Technology: CSS, Html, Javascript, Facebook Box
    Number of Javascript: 6
    Number of meta tags: 4
  9. Move in Ready demo – Agent Evolution and IDXBroker
    San Antonio (United States) - 192.237.175.46
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Lightbox, Php, Pingback, SVG, Wordpress
    Number of Javascript: 13
    Number of meta tags: 3
  10. Jacob E. Miles | Lic. Assoc. Real Estate Broker
    Jacob E. Miles | Lic. Assoc. Real Estate Broker | Halstead Property, LLC
    Scottsdale (United States) - 184.168.221.28
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 2

Check Other Websites