Loading...
Statistics
Advertisement

TOTM: Therapy on the Move
www.totm.life/
TOTM | Therapy on the Move. A counselling team in Bayside, Victoria, CBT (Cognitive Behavioural Therapy) approaches and Clinical Family Therapy

Totm.life

Advertisement
Conversion Technology Metas Server
Totm.life is hosted in United States . Totm.life uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: TQIz9b1OS-YYhQl...NEYqC39.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: cloudflare-nginx. Its CMS is: Squarespace.

Technologies in use by Totm.life

Technology

Number of occurences: 6
  • CSS
  • Html
  • Javascript
  • Lightbox
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 1
  • TQIz9b1OS-YYhQldEXEfqYXDQgyuWxB9MvVSnwpGj3SfelIIf4e6pUJ6wRMU5QwXFmvuFRZ8jQqkFR8RjAsKFc4cFh93Z2Suw26-ZWiaikoXdaslOcUTZc9CieNXdPoC-AZ8OeUzjhBC-eNDifUX-emkjWgodhoX-emldaZ8O1FUiABkZWF3jAF8OcFzdP37O1sGZW4ySY8zd1sGZAuzic90SaBujW48Sagyjh90jhNlJygcScmTZhyXOWFyd1wlSY4zJ6iRjAUCiAoyJ68ciWsuScIlSYbKgcmuScN3jPG4f4gTIMMjMkMfH6qJqAqbMg6FJMJ7fbRHmsMMeMb6MKG4fJuTIMMj2KMfH6qJqcqbMg6BJMJ7fbKQ-sMMeMv6MKG4f4sTIMMjgKMfH6qJ8AqbMg6bJMJ7fbK5-sMMeMS6MKG4fJNTIMMjIPMfH6qJ8cqbMg64JMJ7fbKW-sMMegw6MKG4f4M3IMIjMkMfH6qJDbvbMs6IJMJ7fbR52UMgeMt6MKG4f5JVIMIjgKMfH6qJtbvbMs6bJMJ7fbRV2UMgeMS6MKG4fFMVIMIjIPMfH6qJcUMbMs64JMJ7fbKemsMfeMw6MKG4fJFmIMJj2PMfH6qJyB9bMy6IJMJ7fbKBmsMfeMt6MKG4fVN9IMJjgPMfH6qJ6B9bMy6VJMJ7fbKgmsMfeMS6MKG4fJ4mIMJjIPMfH6qJyu9bMy6JJMJ7fbKJmsMfegJ6MKG4fH8oIMwjMkMfH6GJttjgIMwj2PMfH6qJ71qbMU6IJMJ7f6Rqy6IbMU65JMJ7fbKGpsM2eMS6MKGHf5AeMsM2egI6MTMgNEYqC39.js

Content Management System

Number of occurences: 1
  • Squarespace

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • cloudflare-nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Totm.life

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Multi-Domain/CN=sni164656.cloudflaressl.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Multi-Domain
      • CN: sni164656.cloudflaressl.com
    • hash: 172531ba
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO ECC Domain Validation Secure Server CA 2
    • version: 2
    • serialNumber: 248446341379281878876869405066314983515
    • validFrom: 160909000000Z
    • validTo: 170312235959Z
    • validFrom_time_t: 1473379200
    • validTo_time_t: 1489363199
    • extensions:
      • authorityKeyIdentifier: keyid:40:09:61:67:F0:BC:83:71:4F:DE:12:08:2C:6F:D4:D4:2B:76:3D:96
      • subjectKeyIdentifier: 08:03:39:92:3C:59:F1:8C:6D:D8:57:E5:59:B9:34:F0:C6:F8:75:FF
      • keyUsage: Digital Signature
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crt OCSP - URI:http://ocsp.comodoca4.com
      • subjectAltName: DNS:sni164656.cloudflaressl.com, DNS:*.accidentattorneysf.com, DNS:*.accidentlegaldirectory.com, DNS:*.airbagaccidentlawsuit.com, DNS:*.airbaginjurylawsuits.com, DNS:*.babelyx.com, DNS:*.bbcaction.com, DNS:*.bestnorcalhvac.com, DNS:*.blogsoftnewsu.xyz, DNS:*.blogsofttool96.xyz, DNS:*.californiaabagado.com, DNS:*.californiaaccidentdirectory.com, DNS:*.californiaairbaglawsuit.com, DNS:*.californiaconstructiondefectlawyer.com, DNS:*.californiazofranlawsuit.com, DNS:*.chryslerignitionlawsuit.com, DNS:*.coachellalawyer.com, DNS:*.hip-problems.com, DNS:*.hustler.ai, DNS:*.hustler.social, DNS:*.injuryfrombirth.com, DNS:*.invokana-problems.com, DNS:*.kctlegal.com, DNS:*.kneerecallresourcecenter.com, DNS:*.kusovy-koberec.eu, DNS:*.lasvegaslawfirmmarketing.com, DNS:*.legalselfie.com, DNS:*.masstortreport.com, DNS:*.millerinjurylaw.com, DNS:*.mmattorneys.com, DNS:*.navistarlawsuit.com, DNS:*.negotiatelikethepros.com, DNS:*.omnipoddefectresourcecenter.com, DNS:*.paxil-problems-lawsuit.com, DNS:*.philadelphialawfirmmarketing.net, DNS:*.phoenixlawfirmmarketing.com, DNS:*.pms35.nl, DNS:*.previewmediasmack.net, DNS:*.renolawfirmmarketing.com, DNS:*.risperdal-problems.com, DNS:*.selfio.eu, DNS:*.ssriproblems.com, DNS:*.stevensonmurray.com, DNS:*.talcumpowderproblems.com, DNS:*.thelegalinfo.guru, DNS:*.totm.life, DNS:*.tubanten.nl, DNS:*.underwroughtgomphocarpusparticipative.site, DNS:*.vanslut.com, DNS:*.verywebsitesofti6.xyz, DNS:accidentattorneysf.com, DNS:accidentlegaldirectory.com, DNS:airbagaccidentlawsuit.com, DNS:airbaginjurylawsuits.com, DNS:babelyx.com, DNS:bbcaction.com, DNS:bestnorcalhvac.com, DNS:blogsoftnewsu.xyz, DNS:blogsofttool96.xyz, DNS:californiaabagado.com, DNS:californiaaccidentdirectory.com, DNS:californiaairbaglawsuit.com, DNS:californiaconstructiondefectlawyer.com, DNS:californiazofranlawsuit.com, DNS:chryslerignitionlawsuit.com, DNS:coachellalawyer.com, DNS:hip-problems.com, DNS:hustler.ai, DNS:hustler.social, DNS:injuryfrombirth.com, DNS:invokana-problems.com, DNS:kctlegal.com, DNS:kneerecallresourcecenter.com, DNS:kusovy-koberec.eu, DNS:lasvegaslawfirmmarketing.com, DNS:legalselfie.com, DNS:masstortreport.com, DNS:millerinjurylaw.com, DNS:mmattorneys.com, DNS:navistarlawsuit.com, DNS:negotiatelikethepros.com, DNS:omnipoddefectresourcecenter.com, DNS:paxil-problems-lawsuit.com, DNS:philadelphialawfirmmarketing.net, DNS:phoenixlawfirmmarketing.com, DNS:pms35.nl, DNS:previewmediasmack.net, DNS:renolawfirmmarketing.com, DNS:risperdal-problems.com, DNS:selfio.eu, DNS:ssriproblems.com, DNS:stevensonmurray.com, DNS:talcumpowderproblems.com, DNS:thelegalinfo.guru, DNS:totm.life, DNS:tubanten.nl, DNS:underwroughtgomphocarpusparticipative.site, DNS:vanslut.com, DNS:verywebsitesofti6.xyz

Meta - Totm.life

Number of occurences: 8
  • Name:
    Content: http://static1.squarespace.com/static/566ea9269cadb6bf7e0d7508/t/566eb36ae0327c1e779a1d96/1450095567847/?format=1000w
  • Name: viewport
    Content: width=device-width,initial-scale=1,shrink-to-fit=no
  • Name: twitter:title
    Content: TOTM: Therapy on the Move
  • Name: twitter:image
    Content: http://static1.squarespace.com/static/566ea9269cadb6bf7e0d7508/t/566eb36ae0327c1e779a1d96/1450095567847/?format=1000w
  • Name: twitter:url
    Content: http://www.totm.life/
  • Name: twitter:card
    Content: summary
  • Name: description
    Content: TOTM | Therapy on the Move. A counselling team in Bayside, Victoria, CBT (Cognitive Behavioural Therapy) approaches and Clinical Family Therapy
  • Name: google-site-verification
    Content: WYq6gNQCmSMgYSpVaVSYZZWQnf0uLqP6wXrfcn1jy0E

Server / Hosting

  • IP: 104.31.71.202
  • Latitude: 37.75
  • Longitude: -97.82
  • Country: United States

Rname

  • vick.ns.cloudflare.com
  • deb.ns.cloudflare.com
  • alt4.aspmx.l.google.com
  • alt1.aspmx.l.google.com
  • alt2.aspmx.l.google.com
  • alt3.aspmx.l.google.com
  • aspmx.l.google.com

Target

  • dns.cloudflare.com

HTTP Header Response

HTTP/1.1 200 OK Date: Thu, 29 Sep 2016 04:43:51 GMT Content-Type: text/html; charset=UTF-8 Set-Cookie: __cfduid=dc2699d6b2502210dd58af4d81223d27f1475124231; expires=Fri, 29-Sep-17 04:43:51 GMT; path=/; domain=.totm.life; HttpOnly X-ServedBy: web126 Set-Cookie: crumb=BNnVZufeZQEKZWUxZTQ0MTA4YjI3OTY0MGMxZDU5YjQ3MzBiNzg4;Path=/ Expires: Thu, 01 Jan 1970 00:00:00 GMT Set-Cookie: SS_MID=1e92a112-129c-47a2-a042-baf408015659itnuvpbx;Path=/;Domain=.totm.life;Expires=Sun, 27-Sep-2026 04:43:51 GMT X-PC-Key: LEsrHGl0NrDWJN7KE4Nqd8VDSTA-therapyonthemove X-PC-Hit: false X-PC-AppVer: 9005 Vary: Accept-Encoding, User-Agent X-ContextId: th66Z8fr/XFyMZRUJ X-Via: 1.1 echo106 Server: cloudflare-nginx CF-RAY: 2e9cc6cc363254f8-ORD X-Cache: MISS from s_hv897 Transfer-Encoding: chunked Via: 1.1 s_hv897 (squid/3.5.20) Connection: keep-alive

DNS

host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.31.70.202
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.31.71.202
host: totm.life
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: vick.ns.cloudflare.com
host: totm.life
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: deb.ns.cloudflare.com
host: totm.life
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: deb.ns.cloudflare.com
  5. rname: dns.cloudflare.com
  6. serial: 2020501690
  7. refresh: 10000
  8. retry: 2400
  9. expire: 604800
  10. minimum-ttl: 3600
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: alt4.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 5
  5. target: alt1.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 5
  5. target: alt2.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: alt3.aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 1
  5. target: aspmx.l.google.com
host: totm.life
  1. class: IN
  2. ttl: 300
  3. type: TXT
  4. txt: google-site-verification=ZMqFxbfypWHONkcLXdLy3_7C0tiwizun_R6YFo6JvTg
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.otm.life, www.tqotm.life, www.qotm.life, www.taotm.life, www.aotm.life, www.t otm.life, www. otm.life, www.twotm.life, www.wotm.life, www.teotm.life, www.eotm.life, www.tzotm.life, www.zotm.life, www.txotm.life, www.xotm.life, www.tcotm.life, www.cotm.life, www.ttm.life, www.tobtm.life, www.tbtm.life, www.tohtm.life, www.thtm.life, www.togtm.life, www.tgtm.life, www.tojtm.life, www.tjtm.life, www.tomtm.life, www.tmtm.life, www.to tm.life, www.t tm.life, www.tovtm.life, www.tvtm.life, www.tom.life, www.totqm.life, www.toqm.life, www.totam.life, www.toam.life, www.tot m.life, www.to m.life, www.totwm.life, www.towm.life, www.totem.life, www.toem.life, www.totzm.life, www.tozm.life, www.totxm.life, www.toxm.life, www.totcm.life, www.tocm.life, www.tot.life, www.totmp.life, www.totp.life, www.totmo.life, www.toto.life, www.totmi.life, www.toti.life, www.totmk.life, www.totk.life, www.totm..life, www.tot..life, www.totmu.life, www.totu.life, www.totmj.life, www.totj.life, www.totmn.life, www.totn.life, www.totm-.life, www.tot-.life,

Other websites we recently analyzed

  1. AMARELLA - Räucherwerk aus der Natur
    Germany - 87.238.192.103
    Server software: Apache
    Technology: Html
    Number of meta tags: 5
  2. MISSOURI RIVER REGIONAL LIBRARY
    Columbia (United States) - 207.160.148.90
    G Analytics ID: UA-35550638-1
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Font Awesome, Gravatar, Html, Html5, Javascript, jQuery, jQuery Cookie, Php, Pingback, Revslider, Shortcodes, W3 Total cache, Google Analytics, WordPress Stats, Wordpress
    Number of Javascript: 46
    Number of meta tags: 5
  3. AMS Digital Publishing |
    United Kingdom - 80.82.112.130
    Server software: Apache
    Technology: CSS, Cufon, Fancybox, Gravatar, Html, Javascript, jQuery, Php, Pingback, Shortcodes, SuperFish, W3 Total cache, WordPress Stats, Wordpress
    Number of Javascript: 14
    Number of meta tags: 2
  4. Авторский сайт Ирины Можаевой
    Russian Federation - 81.177.139.235
    Server software: Jino.ru/mod_pizza
    Technology: AJAX Libraries API, CSS, Html, Javascript, JW Player, Php
    Number of Javascript: 4
    Number of meta tags: 2
  5. fashionforcurves.co.uk
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  6. royalteacoffeesticks.com
    royalteacoffeesticks.com
    Scottsdale (United States) - 160.153.162.14
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 3
  7. This Website is Hosted at WinHost Discount Windows Hosting Platform
    Pasadena (United States) - 96.31.35.129
    Server software: Microsoft-IIS/8.0
    Technology: Html
  8. www.vr24.pl - Wirtualne wycieczki , Panoramy 360 , Zdjęcia panoramiczne 3D , Wirtualne wizyty
    Firma zajmuje się wykonywaniem i publikacją zdjęć panoramicznych , panoram sferycznych oraz wirtualnych wycieczek . Wykonujemy kompleksowo strony internetowe dla hoteli , restauracji , developerów , centr konferencyjnych itp, Interakcyjne strony internetowe hoteli , pensjonatów , centrów konferencyjnych , restauracji itp Jesteśmy autoryzowanym dystrybutorem Nodal Ninja , Autopano , Easypano
    Poland - 85.128.140.198
    Server software: nginx
    Technology: CSS, Html, Iframe, Javascript, MooTools, Php, Swf Object, Google Analytics, Joomla, Facebook Like box
    Number of Javascript: 7
    Number of meta tags: 5
  9. Pradinis - Dietos sistema
    "Dietos sistema" - pirmoji specializuota dietologijos paslaugas teikianti klinika.
    Lithuania - 79.98.28.15
    G Analytics ID: UA-18832279-1
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Google Analytics, Joomla
    Number of Javascript: 8
    Number of meta tags: 7
  10. Sapphire
    United Kingdom - 93.93.131.127
    Server software:
    Technology: Html
    Number of meta tags: 1

Check Other Websites